PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.05G072100.1.p
Common NameGLYMA_05G072100, LOC102659753
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family FAR1
Protein Properties Length: 817aa    MW: 94129.7 Da    PI: 6.7759
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.05G072100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR172.68.6e-23139225290
                 FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                          +Y+eYA   GFs+rk+  +ks+ ng +++r+++C ++g+r +++ +    r+ ++etrtgC a+++++++ +gk++v+++e+eHnHel+
  Glyma.05G072100.1.p 139 CYSEYAVLNGFSIRKDFVNKSRINGAVVSRRYTCHRQGYRPSKNGT--YLRKLKQETRTGCLAHMTISRQPNGKFCVINFETEHNHELV 225
                          7***************************************998877..99999**********************************97 PP

2FAR189.74.2e-28272360190
                 FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                          +fYn+YA +vGFsvrk++ ++sk +g + +r+f+C +eg+r+++k++ ++ +r+r+ tr+gC a+l+++++ dg++++t++e++HnHel+
  Glyma.05G072100.1.p 272 EFYNTYAGHVGFSVRKDYVNRSKVDGAVASRRFTCFREGFRHKDKQD-TNVKRPRKDTRIGCLAQLVISRQPDGRYHITHFEEKHNHELV 360
                          6*******************************************999.999*************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.6E-20139225IPR004330FAR1 DNA binding domain
PfamPF031013.7E-25272360IPR004330FAR1 DNA binding domain
PfamPF105511.5E-23481574IPR018289MULE transposase domain
PROSITE profilePS509669.384761797IPR007527Zinc finger, SWIM-type
SMARTSM005758.3E-5772799IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 817 aa     Download sequence    Send to blast
MQDTEPDIKR HPLEDAENEC PISPEVVIDM GQESQTQNHS DFSVSDTNKV IDTENECTSP  60
NVCPVDNSHM EINDECQTSN IFHVDKFPTN VSSGQLCETE NPCATFVTMT STDVKNEEEI  120
CVAPKIGMEF ESEDTAYKCY SEYAVLNGFS IRKDFVNKSR INGAVVSRRY TCHRQGYRPS  180
KNGTYLRKLK QETRTGCLAH MTISRQPNGK FCVINFETEH NHELVTPCTA HMLQSQKRLT  240
FAQAVEANLT KSGLDGVPKL GMGFDSEEHA YEFYNTYAGH VGFSVRKDYV NRSKVDGAVA  300
SRRFTCFREG FRHKDKQDTN VKRPRKDTRI GCLAQLVISR QPDGRYHITH FEEKHNHELV  360
AACRVHMLRS QKKLATTQVE KNIADGSNVL PTSTSESNCK AIEGFVDMDC DPMGHEYKLP  420
FKCTSKMKEG EIEKIKHHFQ IKQSKNPSFF YAFQLDADDQ ITNIFWADTK MMVDYGDFGD  480
VICFDSSYKY YKDFRPFVPF LGINNHQQMT IFGAALLYNE SVESLKWLFR VFIEAMSGRK  540
PKTILTDLDI ITAEAINSIS PQTNHRVCVW HVYQDALKQL SHVSVRSGSF VNDLRSCFFD  600
NEEEDYFVNA WNALLDKYDL WQNEWLQQIY GSRDRWAIAY GRQFFCADMV SMLLRENLTG  660
NLKKYLKHGT DILPLLKYLV KVVTDWHYRE LEANYDMSQH MPPLMGDIIT LKHASAPYTP  720
KIFELFQKEY EACLNLVIKH CTESGSLYNY KVSIYEQVRE YSVTFDSSNK TISCCCMKFE  780
YVGILCCHAL KVLDYRNIRI VPSQYILKRW TKDARV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006579691.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 7-like isoform X1
TrEMBLA0A0R0JYC70.0A0A0R0JYC7_SOYBN; Uncharacterized protein
STRINGGLYMA05G06351.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Representative plantOGRP3012351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-112FAR1-related sequence 5